B7-1 (CD80) (NM_005191) Human Mass Spec Standard
CAT#: PH306540
CD80 MS Standard C13 and N15-labeled recombinant protein (NP_005182)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206540 |
Predicted MW | 33 kDa |
Protein Sequence |
>RC206540 protein sequence
Red=Cloning site Green=Tags(s) MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEK KMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKA DFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTT NHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERL RRESVRPV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005182 |
RefSeq Size | 2757 |
RefSeq ORF | 864 |
Synonyms | B7; B7-1; B7.1; BB1; CD28LG; CD28LG1; LAB7 |
Locus ID | 941 |
UniProt ID | P33681, A0N0P2 |
Cytogenetics | 3q13.33 |
Summary | The protein encoded by this gene is a membrane receptor that is activated by the binding of CD28 or CTLA-4. The activated protein induces T-cell proliferation and cytokine production. This protein can act as a receptor for adenovirus subgroup B and may play a role in lupus neuropathy. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome, Transcription Factors, Transmembrane |
Protein Pathways | Allograft rejection, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Graft-versus-host disease, Systemic lupus erythematosus, Toll-like receptor signaling pathway, Type I diabetes mellitus, Viral myocarditis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP306540 | Recombinant protein of human CD80 molecule (CD80), 20 µg |
USD 867.00 |
|
TP700242 | Purified recombinant protein of human CD80 molecule (CD80), with C-terminal Fc/His tag, expressed in human cells, 20 µg |
USD 867.00 |
|
TP700243 | Purified recombinant protein of human CD80 molecule (CD80), with C-terminal DDK/His tag, expressed in human cells, 20 µg |
USD 867.00 |
|
TP724008 | Human B7-1 Protein, hFc Tag |
USD 545.00 |
{0} Product Review(s)
Be the first one to submit a review