Ubiquilin (UBQLN1) (NM_053067) Human Mass Spec Standard
CAT#: PH304020
UBQLN1 MS Standard C13 and N15-labeled recombinant protein (NP_444295)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204020 |
Predicted MW | 59.2 kDa |
Protein Sequence |
>RC204020 protein sequence
Red=Cloning site Green=Tags(s) MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPKEKEEFAVPENSSVQQFKEEISKRFK SHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDHSAQQTNTAGSNVTTSSTPNSNSTSG SATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLLSNPEMMVQIMENPFVQSMLSNPDLMRQLIM ANPQMQQLIQRNPEISHMLNNPDIMRQTLELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQ EPMLSAAQEQFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTASTVGGTTGSTA SGTSGQSTTAPNLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQMQNP DTLSAMSNPRAMQALLQIQQGLQTLATEAPGLIPGFTPGLGALGSTGGSSGTNGSNATPSENTSPTAGTT EPGHQQFIQQMLQALAGVNPQLQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQP S myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_444295 |
RefSeq Size | 4093 |
RefSeq ORF | 1683 |
Synonyms | DA41; DSK2; PLIC-1; UBQN; XDRP1 |
Locus ID | 29979 |
UniProt ID | Q9UMX0, A0A024R258 |
Cytogenetics | 9q21.2-q21.3 |
Summary | This gene encodes an ubiquitin-like protein (ubiquilin) that shares a high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain an N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to modulate accumulation of presenilin proteins, and it is found in lesions associated with Alzheimer's and Parkinson's disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402265 | UBQLN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC409314 | UBQLN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402265 | Transient overexpression lysate of ubiquilin 1 (UBQLN1), transcript variant 1 |
USD 436.00 |
|
LY409314 | Transient overexpression lysate of ubiquilin 1 (UBQLN1), transcript variant 2 |
USD 436.00 |
|
PH306897 | UBQLN1 MS Standard C13 and N15-labeled recombinant protein (NP_038466) |
USD 3,255.00 |
|
TP304020 | Recombinant protein of human ubiquilin 1 (UBQLN1), transcript variant 2, 20 µg |
USD 867.00 |
|
TP306897 | Recombinant protein of human ubiquilin 1 (UBQLN1), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review