RANTES (CCL5) (NM_002985) Human Mass Spec Standard
CAT#: PH303799
CCL5 MS Standard C13 and N15-labeled recombinant protein (NP_002976)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203799 |
Predicted MW | 10 kDa |
Protein Sequence |
>RC203799 protein sequence
Red=Cloning site Green=Tags(s) MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNR QVCANPEKKWVREYINSLEMS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002976 |
RefSeq Size | 1237 |
RefSeq ORF | 273 |
Synonyms | D17S136E; eoCP; RANTES; SCYA5; SIS-delta; SISd; TCP228 |
Locus ID | 6352 |
UniProt ID | P13501, D0EI67 |
Cytogenetics | 17q12 |
Summary | This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Epithelial cell signaling in Helicobacter pylori infection, NOD-like receptor signaling pathway, Prion diseases, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401044 | CCL5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401044 | Transient overexpression lysate of chemokine (C-C motif) ligand 5 (CCL5) |
USD 436.00 |
|
TP303799 | Recombinant protein of human chemokine (C-C motif) ligand 5 (CCL5), 20 µg |
USD 867.00 |
|
TP720050 | Recombinant protein of human chemokine (C-C motif) ligand 5 (CCL5) |
USD 330.00 |
|
TP723778 | Purified recombinant protein of Human chemokine (C-C motif) ligand 5 (CCL5 / RANTES) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review