HSD17B2 (NM_002153) Human Mass Spec Standard

CAT#: PH303293

HSD17B2 MS Standard C13 and N15-labeled recombinant protein (NP_002144)

Product Images

Coomassie blue staining of purified HSD17B2 protein (Cat# TP303293). The protein was produced from HEK293T cells transfected with HSD17B2 cDNA clone (Cat# RC203293) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203293
• Predicted MW: 42.8 kDa
• Protein Sequence:
  Sequence Link

  >RC203293 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYT
  YLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDIT
  KPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKS
  KGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLE
  KDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICL
  AHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002144
• RefSeq Size: 1451
• RefSeq ORF: 1161
• Synonyms: EDH17B2; HSD17; SDR9C2
• Locus ID: 3294
• UniProt ID: P37059
• Cytogenetics: 16q23.3
• Summary: Capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Androgen and estrogen metabolism, Metabolic pathways