NRAS (NM_002524) Human Mass Spec Standard
CAT#: PH302681
NRAS MS Standard C13 and N15-labeled recombinant protein (NP_002515)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202681 |
Predicted MW | 21.2 kDa |
Protein Sequence |
>RC202681 protein sequence
Red=Cloning site Green=Tags(s) MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQ YMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIP FIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002515 |
RefSeq Size | 4454 |
RefSeq ORF | 567 |
Synonyms | ALPS4; CMNS; N-ras; NCMS; NRAS1; NS6 |
Locus ID | 4893 |
UniProt ID | P01111, Q5U091 |
Cytogenetics | 1p13.2 |
Summary | This is an N-ras oncogene encoding a membrane protein that shuttles between the Golgi apparatus and the plasma membrane. This shuttling is regulated through palmitoylation and depalmitoylation by the ZDHHC9-GOLGA7 complex. The encoded protein, which has intrinsic GTPase activity, is activated by a guanine nucleotide-exchange factor and inactivated by a GTPase activating protein. Mutations in this gene have been associated with somatic rectal cancer, follicular thyroid cancer, autoimmune lymphoproliferative syndrome, Noonan syndrome, and juvenile myelomonocytic leukemia. [provided by RefSeq, Jun 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Acute myeloid leukemia, Axon guidance, B cell receptor signaling pathway, Bladder cancer, Chemokine signaling pathway, Chronic myeloid leukemia, Endometrial cancer, ErbB signaling pathway, Fc epsilon RI signaling pathway, Gap junction, Glioma, GnRH signaling pathway, Insulin signaling pathway, Long-term depression, Long-term potentiation, MAPK signaling pathway, Melanogenesis, Melanoma, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway, Non-small cell lung cancer, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway, Thyroid cancer, Tight junction, VEGF signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400901 | NRAS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400901 | Transient overexpression lysate of neuroblastoma RAS viral (v-ras) oncogene homolog (NRAS) |
USD 436.00 |
|
TP302681 | Recombinant protein of human neuroblastoma RAS viral (v-ras) oncogene homolog (NRAS), 20 µg |
USD 867.00 |
|
TP701004 | Purified recombinant protein of Homo sapiens neuroblastoma RAS viral (v-ras) oncogene homolog (NRAS), mutant (Q61K), expressed in HEK293 cells, 20ug |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review