Suppressor of Fused (SUFU) (NM_016169) Human Mass Spec Standard

CAT#: PH301021

SUFU MS Standard C13 and N15-labeled recombinant protein (NP_057253)

Product Images

Coomassie blue staining of purified SUFU protein (Cat# TP301021). The protein was produced from HEK293T cells transfected with SUFU cDNA clone (Cat# RC201021) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201021
• Predicted MW: 53.9 kDa
• Protein Sequence:
  Sequence Link

  >RC201021 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAELRPSGAPGPTAPPAPGPTAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKYWLGGPDPLDY
  VSMYRNVGSPSANIPEHWHYISFGLSDLYGDNRVHEFTGTDGPSGFGFELTFRLKRETGESAPPTWPAEL
  MQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLTEDPQMQPVQTPFGVVTFLQIVGVCTEELHS
  AQQWNGQGILELLRTVPIAGGPWLITDMRRGETIFEIDPHLQERVDKGIETDGSNLSGVSAKCAWDDLSR
  PPEDDEDSRSICIGTQPRRLSGKDTEQIRETLRRGLEINSKPVLPPINPQRQNGLAHDRAPSRKDSLESD
  SSTAIIPHELIRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFATE
  EHPYAAHGPWLQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVFDSPLH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057253
• RefSeq Size: 4994
• RefSeq ORF: 1452
• Synonyms: JBTS32; PRO1280; SUFUH; SUFUXL
• Locus ID: 51684
• UniProt ID: Q9UMX1
• Cytogenetics: 10q24.32
• Summary: The Hedgehog signaling pathway plays an important role in early human development. The pathway is a signaling cascade that plays a role in pattern formation and cellular proliferation during development. This gene encodes a negative regulator of the hedgehog signaling pathway. Defects in this gene are a cause of medulloblastoma. Alternative splicing results in multiple transcript variants.[provided by RefSeq, May 2010]
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Basal cell carcinoma, Hedgehog signaling pathway, Pathways in cancer