BubR1 (BUB1B) (NM_001211) Human Mutant ORF Clone

CAT#: RC402561

BUB1B Mutant (R194X), Myc-DDK-tagged ORF clone of Homo sapiens budding uninhibited by benzimidazoles 1 homolog beta (yeast) (BUB1B) as transfection-ready DNA

Specifications

Product Data

• Mutation Description: R194X
• Affected Codon#: 194
• Affected NT#: 580
• Tag: Myc-DDK
• Effect: Mosi vrieed neuploidy
• Symbol: BUB1B
• Synonyms: Bub1A; BUB1beta; BUBR1; hBUBR1; MAD3L; MVA1; SSK1
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Vector: pCMV6-Entry
• ACCN: NM_001211
• ORF Size: 579 bp
• Sequence Data:
  ORF Nucleotide Sequence

  >RC402561 representing NM_001211
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGGCGGTGAAGAAGGAAGGGGGTGCTCTGAGTGAAGCCATGTCCCTGGAGGGAGATGAATGGGAAC
  TGAGTAAAGAAAATGTACAACCTTTAAGGCAAGGGCGGATCATGTCCACGCTTCAGGGAGCACTGGCACA
  AGAATCTGCCTGTAACAATACTCTTCAGCAGCAGAAACGGGCATTTGAATATGAAATTCGATTTTACACT
  GGAAATGACCCTCTGGATGTTTGGGATAGGTATATCAGCTGGACAGAGCAGAACTATCCTCAAGGTGGGA
  AGGAGAGTAATATGTCAACGTTATTAGAAAGAGCTGTAGAAGCACTACAAGGAGAAAAACGATATTATAG
  TGATCCTCGATTTCTCAATCTCTGGCTTAAATTAGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGT
  TACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCATGGGCAGAAGAATATGAAG
  CTAGAGAAAACTTTAGGAAAGCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGA
  AAGACTACAGTCCCAGCAC
  
  AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
  TGGATTACAAGGATGACGACGA TAAGGTTTAA
  Protein Sequence

  >RC402561 representing NM_001211
  Red=Cloning site Green=Tags(s)
  
  MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYT
  GNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGRLCNEPLDMYS
  YLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQH
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).

Reference Data

• RefSeq: NP_001202
• RefSeq Size: 579 bp
• RefSeq ORF: 3153 bp
• Locus ID: 701
• Cytogenetics: 15q15.1
• Protein Families: Druggable Genome, Protein Kinase, Stem cell - Pluripotency
• Protein Pathways: Cell cycle
• MW: 21.2 kDa
• Gene Summary: This gene encodes a kinase involved in spindle checkpoint function. The protein has been localized to the kinetochore and plays a role in the inhibition of the anaphase-promoting complex/cyclosome (APC/C), delaying the onset of anaphase and ensuring proper chromosome segregation. Impaired spindle checkpoint function has been found in many forms of cancer. [provided by RefSeq, Jul 2008]