MAGEB1 (NM_002363) Human Tagged ORF Clone

CAT#: RG215656

  • TrueORF®

MAGEB1 (tGFP-tagged) - Human melanoma antigen family B, 1 (MAGEB1), transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro


  "NM_002363" in other vectors (6)

Reconstitution Protocol

USD 886.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


MAGEB1 mouse monoclonal antibody, clone OTI4E12 (formerly 4E12)
    • 100 ul

USD 447.00

Other products for "MAGEB1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol MAGEB1
Synonyms CT3.1; DAM10; MAGE-Xp; MAGEL1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG215656 representing NM_002363
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTCGGGGTCAGAAGAGTAAGCTCCGTGCTCGTGAGAAACGCCGCAAGGCGCGAGAGGAGACCCAGG
GTCTCAAGGTTGCTCACGCCACTGCAGCAGAGAAAGAGGAGTGCCCCTCCTCCTCTCCTGTTTTAGGGGA
TACTCCCACAAGCTCCCCTGCTGCTGGCATTCCCCAGAAGCCTCAGGGAGCTCCACCCACCACCACTGCT
GCTGCAGCTGTGTCATGTACCGAATCTGACGAAGGTGCCAAATGCCAAGGTGAGGAAAATGCAAGTTTCT
CCCAGGCCACAACATCCACTGAGAGCTCAGTCAAAGATCCTGTAGCCTGGGAGGCAGGAATGCTGATGCA
CTTCATTCTACGTAAGTATAAAATGAGAGAGCCCATTATGAAGGCAGATATGCTGAAGGTTGTTGATGAA
AAGTACAAGGATCACTTCACTGAGATCCTCAATGGAGCCTCTCGCCGCTTGGAGCTCGTCTTTGGCCTTG
ATTTGAAGGAAGACAACCCTAGTGGCCACACCTACACCCTCGTCAGTAAGCTAAACCTCACCAATGATGG
AAACCTGAGCAATGATTGGGACTTTCCCAGGAATGGGCTTCTGATGCCTCTCCTGGGTGTGATCTTCTTA
AAGGGCAACTCTGCCACCGAGGAAGAGATCTGGAAATTCATGAATGTGTTGGGAGCCTATGATGGAGAGG
AGCACTTAATCTATGGGGAACCCCGTAAGTTCATCACCCAAGATCTGGTGCAGGAAAAATATCTGAAGTA
CGAGCAGGTGCCCAACAGTGATCCCCCACGCTATCAATTCCTATGGGGTCCGAGAGCCTATGCTGAAACC
ACCAAGATGAAAGTCCTCGAGTTTTTGGCCAAGATGAATGGTGCCACTCCCCGTGACTTCCCATCCCATT
ATGAAGAGGCTTTGAGAGATGAGGAAGAGAGAGCCCAAGTCCGATCCAGTGTTAGAGCCAGGCGTCGCAC
TACTGCCACGACTTTTAGAGCGCGTTCTAGAGCCCCATTCAGCAGGTCCTCCCACCCCATG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG215656 representing NM_002363
Red=Cloning site Green=Tags(s)

MPRGQKSKLRAREKRRKAREETQGLKVAHATAAEKEECPSSSPVLGDTPTSSPAAGIPQKPQGAPPTTTA
AAAVSCTESDEGAKCQGEENASFSQATTSTESSVKDPVAWEAGMLMHFILRKYKMREPIMKADMLKVVDE
KYKDHFTEILNGASRRLELVFGLDLKEDNPSGHTYTLVSKLNLTNDGNLSNDWDFPRNGLLMPLLGVIFL
KGNSATEEEIWKFMNVLGAYDGEEHLIYGEPRKFITQDLVQEKYLKYEQVPNSDPPRYQFLWGPRAYAET
TKMKVLEFLAKMNGATPRDFPSHYEEALRDEEERAQVRSSVRARRRTTATTFRARSRAPFSRSSHPM

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002363
ORF Size 1041 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002363.5
RefSeq Size 1865 bp
RefSeq ORF 1044 bp
Locus ID 4112
UniProt ID P43366
Cytogenetics Xp21.2
Gene Summary This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. This gene is localized in the DSS (dosage-sensitive sex reversal) critical region, and expressed in testis and in a significant fraction of tumors of various histological types. This gene and other MAGEB members are clustered on chromosome Xp22-p21. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene, however, the full length nature of some variants has not been defined. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.