UQCRFS1 (NM_006003) Human Tagged ORF Clone

CAT#: RG204051

  • TrueORF®

UQCRFS1 (tGFP-tagged) - Human ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 (UQCRFS1), nuclear gene encoding mitochondrial protein

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_006003" in other vectors (4)

Reconstitution Protocol

USD 650.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


UQCRFS1 mouse monoclonal antibody,clone OTI4H8
    • 100 ul

USD 447.00

Other products for "UQCRFS1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol UQCRFS1
Synonyms MC3DN10; RIP1; RIS1; RISP; UQCR5
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG204051 representing NM_006003
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGTCGGTAGCAGCCCGCTCGGGCCCGTTCGCGCCCGTCCTGTCGGCCACGTCCCGCGGGGTGGCGG
GCGCGCTGCGGCCCTTGGTGCAGGCCACGGTGCCCGCCACCCCGGAGCAGCCTGTGTTGGACCTGAAGCG
GCCCTTCCTCAGCCGGGAGTCGCTGAGCGGCCAGGCCGTGCGCCGGCCTTTGGTCGCCTCCGTGGGCCTC
AATGTCCATGCTTCTGTTTGTTATTCCCACACAGACATCAAGGTGCCTGACTTCTCTGAATACCGCCGCC
TTGAAGTTTTAGATAGTACGAAGTCTTCAAGAGAAAGCAGCGAGGCTAGGAAAGGTTTCTCCTATTTGGT
AACTGGAGTAACTACTGTGGGTGTCGCATATGCTGCCAAGAATGCCGTCACCCAGTTCGTTTCCAGCATG
AGTGCTTCTGCTGATGTGTTGGCCCTGGCGAAAATCGAAATCAAGTTATCCGATATTCCAGAAGGCAAGA
ACATGGCTTTCAAATGGAGAGGCAAACCCCTGTTTGTGCGTCATAGAACCCAGAAGGAAATTGAGCAGGA
AGCTGCAGTTGAATTATCACAGTTGAGGGACCCACAGCATGATCTAGATCGAGTAAAGAAACCTGAATGG
GTTATCCTGATAGGTGTTTGCACTCATCTTGGCTGTGTACCCATTGCAAATGCAGGAGATTTTGGTGGTT
ATTACTGCCCTTGCCATGGGTCACACTATGATGCATCTGGCAGGATCAGATTGGGTCCTGCTCCTCTCAA
CCTTGAAGTCCCCACGTATGAGTTCACCAGTGACGATATGGTGATTGTTGGT


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG204051 representing NM_006003
Red=Cloning site Green=Tags(s)

MLSVAARSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLSRESLSGQAVRRPLVASVGL
NVPASVCYSHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGVTTVGVAYAAKNAVTQFVSSM
SASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEW
VILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG

SGPTRTRRLE - GFP Tag - V
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006003
ORF Size 822 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006003.1, NP_005994.1
RefSeq Size 1203 bp
RefSeq ORF 825 bp
Locus ID 7386
UniProt ID P47985
Cytogenetics 19q12
Domains UCR_TM, Rieske
Protein Pathways Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
Gene Summary Cytochrome b-c1 complex subunit Rieske, mitochondrial: Component of the mitochondrial ubiquinol-cytochrome c reductase complex dimer (complex III dimer), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis (PubMed:28673544). Incorporation of UQCRFS1 is the penultimate step in complex III assembly (PubMed:28673544).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.