GBA3 (NM_001128432) Human Tagged ORF Clone

CAT#: RC225153

GBA3 (Myc-DDK-tagged)-Human glucosidase, beta, acid 3 (cytosolic) (GBA3), transcript variant 2

Product Images

Circular map for RC225153

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: GBA3
• Synonyms: CBG; CBGL1; GLUC; KLRP
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC225153 representing NM_001128432
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCTTTCCCTGCAGGATTTGGATGGGCGGCAGCCACTGCAGCTTATCAAGTAGAAGGAGGCTGGGATG
  CAGATGGAAAAGGCCCTTGTGTCTGGGACACATTTACTCATCAGGGAGGAGAGAGAGTTTTCAAGAACCA
  GACTGGCGATGTAGCTTGTGGCAGCTACACTCTGTGGGAGGAAGATTTGAAATGTATCAAACAGCTTGGA
  TTGACTCATTACCGCTTCTCTCTTTCCTGGTCACGTCTGTTACCTGATGGGACGACAGGTTTCATCAACC
  AGAAAGCTATCCAACTTGATAAAGTCAATCTTCAAGTATATTGTGCATGGTCTCTTCTGGATAACTTTGA
  GTGGAACCAGGGATACAGCAGCCGGTTTGGTCTCTTCCACGTTGATTTTGAAGACCCAGCTAGACCCCGA
  GTCCCTTACACATCGGCCAAGGAATATGCCAAGATCATCCGAAACAATGGCCTTGAAGCACATCTG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC225153 representing NM_001128432
  Red=Cloning site Green=Tags(s)
  
  MAFPAGFGWAAATAAYQVEGGWDADGKGPCVWDTFTHQGGERVFKNQTGDVACGSYTLWEEDLKCIKQLG
  LTHYRFSLSWSRLLPDGTTGFINQKAIQLDKVNLQVYCAWSLLDNFEWNQGYSSRFGLFHVDFEDPARPR
  VPYTSAKEYAKIIRNNGLEAHL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001128432
• ORF Size: 486 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001128432.2
• RefSeq ORF: 489 bp
• Locus ID: 57733
• UniProt ID: Q9H227
• Cytogenetics: 4p15.2
• Protein Pathways: Cyanoamino acid metabolism, Starch and sucrose metabolism
• MW: 18.1 kDa
• Gene Summary: The protein encoded by this gene is an enzyme that can hydrolyze several types of glycosides. This gene is a polymorphic pseudogene, with the most common allele being the functional allele that encodes the full-length protein. Some individuals, as represented by the reference genome allele, contain a single nucleotide polymorphism that results in a premature stop codon in the coding region, and therefore this allele is pseudogenic due to the failure to produce a functional full-length protein. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Mar 2013]