Foxa2 (NM_001291065) Mouse Tagged ORF Clone

CAT#: MR230052

  • TrueORF®

Foxa2 (myc-DDK-tagged) - Mouse forkhead box A2 (Foxa2), transcript variant 1


  "NM_001291065" in other vectors (1)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 503.00

2 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-Foxa2 Antibody
    • 100 ul

USD 539.00

Other products for "Foxa2"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Foxa2
Synonyms Hnf-3b; HNF3-beta; Hnf3b; HNF3beta; Tcf-3b; Tcf3b
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR230052 representing NM_001291065
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACTCGGCTTCCAGTATGCTGGGAGCCGTGAAGATGGAAGGGCACGAGCCATCCGACTGGAGCAGCT
ACTACGCGGAGCCCGAGGGCTACTCTTCCGTGAGCAACATGAACGCCGGCCTGGGGATGAATGGCATGAA
CACATACATGAGCATGTCCGCGGCTGCCATGGGCGGCGGTTCCGGCAACATGAGCGCGGGCTCCATGAAC
ATGTCATCCTATGTGGGCGCTGGAATGAGCCCGTCGCTAGCTGGCATGTCCCCGGGCGCCGGCGCCATGG
CGGGCATGAGCGGCTCAGCCGGGGCGGCCGGCGTGGCGGGCATGGGACCTCACCTGAGTCCGAGTCTGAG
CCCGCTCGGGGGACAGGCGGCCGGGGCCATGGGTGGCCTTGCCCCCTACGCCAACATGAACTCGATGAGC
CCCATGTACGGGCAGGCCGGCCTGAGCCGCGCTCGGGACCCCAAGACATACCGACGCAGCTACACACACG
CCAAACCTCCCTACTCGTACATCTCGCTCATCACCATGGCCATCCAGCAGAGCCCCAACAAGATGCTGAC
GCTGAGCGAGATCTATCAGTGGATCATGGACCTCTTCCCTTTCTACCGGCAGAACCAGCAGCGCTGGCAG
AACTCCATCCGCCACTCTCTCTCCTTCAACGACTGCTTTCTCAAGGTGCCCCGCTCGCCAGACAAGCCTG
GCAAGGGCTCCTTCTGGACCCTGCACCCAGACTCGGGCAACATGTTCGAGAACGGCTGCTACCTGCGCCG
CCAGAAGCGCTTCAAGTGTGAGAAGCAACTGGCACTGAAGGAAGCCGCGGGTGCGGCCAGTAGCGGAGGC
AAGAAGACCGCTCCTGGGTCCCAGGCCTCTCAGGCTCAGCTCGGGGAGGCCGCGGGCTCGGCCTCCGAGA
CTCCGGCGGGCACCGAGTCCCCCCATTCCAGCGCTTCTCCGTGTCAGGAGCACAAGCGAGGTGGCCTAAG
CGAGCTAAAGGGAGCACCTGCCTCTGCGCTGAGTCCTCCCGAGCCGGCGCCCTCGCCTGGGCAGCAGCAG
CAGGCTGCAGCCCACCTGCTGGGCCCACCTCACCACCCAGGCCTGCCACCAGAGGCCCACCTGAAGCCCG
AGCACCATTACGCCTTCAACCACCCCTTCTCTATCAACAACCTCATGTCGTCCGAGCAGCAACATCACCA
CAGCCACCACCACCATCAGCCCCACAAAATGGACCTCAAGGCCTACGAACAGGTCATGCACTACCCAGGG
GGCTATGGTTCCCCCATGCCAGGCAGCTTGGCCATGGGCCCAGTCACGAACAAAGCGGGCCTGGATGCCT
CGCCCCTGGCTGCAGACACTTCCTACTACCAAGGAGTGTACTCCAGGCCTATTATGAACTCATCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR230052 representing NM_001291065
Red=Cloning site Green=Tags(s)

MHSASSMLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGGGSGNMSAGSMN
MSSYVGAGMSPSLAGMSPGAGAMAGMSGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMS
PMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQ
NSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAASSGG
KKTAPGSQASQAQLGEAAGSASETPAGTESPHSSASPCQEHKRGGLSELKGAPASALSPPEPAPSPGQQQ
QAAAHLLGPPHHPGLPPEAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPG
GYGSPMPGSLAMGPVTNKAGLDASPLAADTSYYQGVYSRPIMNSS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001291065
ORF Size 1395 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001291065.1, NP_001277994.1
RefSeq Size 2070 bp
RefSeq ORF 1398 bp
Locus ID 15376
UniProt ID P35583
Cytogenetics 2 73.38 cM
MW 49.5 kDa
Gene Summary Transcription factor that is involved in embryonic development, establishment of tissue-specific gene expression and regulation of gene expression in differentiated tissues. Is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites. Binds DNA with the consensus sequence 5'-[AC]A[AT]T[AG]TT[GT][AG][CT]T[CT]-3' (By similarity). In embryonic development is required for notochord formation. Involved in the development of multiple endoderm-derived organ systems such as the liver, pancreas and lungs; Foxa1 and Foxa2 seem to have at least in part redundant roles. FOXA1 and FOXA2 are essential for hepatic specification. FOXA1 and FOXA2 are required for morphogenesis and cell differentiation during formation of the lung. FOXA1 and FOXA2 are involved in bile duct formation; they positively regulate the binding glucocorticoid receptor/NR3C1 to the IL6 promoter. FOXA1 and FOXA2 regulate multiple phases of midbrain dopaminergic neuron development; they regulate expression of NEUROG2 at the beginning of mDA neurogenesis and of NR4A2 and EN1 in immature mDA neurons. Modulates the transcriptional activity of nuclear hormone receptors; inhibits AR-mediated transcription from the LCN5 promoter. Binds to fibrinogen beta promoter and is involved in IL6-induced fibrinogen beta transcriptional activation. Originally described as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Interacts with the cis-acting regulatory regions of these genes. Involved in glucose homeostasis; regulates the expression of genes important for glucose sensing in pancreatic beta-cells and glucose homeostasis. In pancreatic beta cells activates transcription of potassium channel subunits KCNJ11 and ABCC8. Involved in regulation of fat metabolism; activates transcriptional programs of lipid metabolism and ketogenesis at low insulin state. Involved in transcriptional regulation of MUC2 in the intestine.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.