Ackr2 (NM_021609) Mouse Tagged ORF Clone

CAT#: MR220989

  • TrueORF®

Ccbp2 (Myc-DDK-tagged) - Mouse chemokine binding protein 2 (Ccbp2)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_021609" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Ackr2"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Ackr2
Synonyms AI464239; Ccbp2; CCR9; CCR10; Cmkbr9; D6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR220989 representing NM_021609
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCACCGTTGCTTCCCCACTGCCTCTCACCACCGTCGGTTCCGAGAACAGCAGCTCCATCTACGACT
ACGACTACTTAGATGATATGACCATCTTGGTTTGCAGGAAGGACGAGGTCCTGTCCTTTGGAAGAGTCTT
TCTGCCGGTCGTCTACAGCCTGATCTTCGTGCTGGGCTTGGCTGGAAACCTCCTCCTCCTGGTGGTGTTG
CTCCACTCTGCACCTCGAAGACGGACGATGGAGCTTTACCTGCTGAACCTGGCCGTCTCCAACCTCTTGT
TTGTAGTGACTATGCCCTTCTGGGCCATCTCTGTGGCCTGGCATTGGGTTTTTGGTAGTTTCCTGTGCAA
GGTGATAAGCACTCTCTACTCTATTAACTTTTACTGTGGTATCTTCTTCATCACCTGCATGAGCCTGGAC
AAATACCTGGAGATTGTCCACGCTCAGCCTCTCCACAGACCGAAGGCCCAGTTCAGGAACCTGCTTCTCA
TTGTCATGGTGTGGATCACATCCCTGGCCATCTCTGTCCCAGAAATGGTCTTTGTGCAGATCCACCAGAC
CTTAGATGGTGTGTGGCACTGCTATGCGGATTTTGGCGGACATGCGACCATTTGGAAGCTGTACCTGCGC
TTCCAGCTGAACCTTCTGGGGTTTCTCCTCCCACTCTTGGCCATGATCTTCTTTTACTCCCGCATCGGTT
GCGTTCTGGTCAGGCTGAGGCCGCCAGGCCAGGGCCGGGCTCTGAGGATGGCCGCGGCCCTGGTGATAGT
TTTCTTCATGCTGTGGTTCCCATATAACCTCACCTTGTTTCTGCACTCGTTGCTGGACCTGCATGTCTTT
GGGAACTGTGAGATCAGCCACCGTCTGGACTATACGTTGCAGGTGACAGAGAGCCTGGCCTTCTCCCACT
GCTGCTTCACCCCGGTCCTCTACGCCTTCTGCAGTCACCGCTTCCGCCGGTACCTGAAGGCATTTCTGTC
TGTGATGTTGAGATGGCACCAGGCACCTGGCACCCCTTCCTCTAACCATTCTGAGAGCAGCAGGGTTACT
GCCCAGGAAGACGTGGTCAGCATGAATGACCTTGGGGAGAGGCAGTCTGAGGACTCCCTTAACAAGGGGG
AGATGGGGAATACT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR220989 representing NM_021609
Red=Cloning site Green=Tags(s)

MPTVASPLPLTTVGSENSSSIYDYDYLDDMTILVCRKDEVLSFGRVFLPVVYSLIFVLGLAGNLLLLVVL
LHSAPRRRTMELYLLNLAVSNLLFVVTMPFWAISVAWHWVFGSFLCKVISTLYSINFYCGIFFITCMSLD
KYLEIVHAQPLHRPKAQFRNLLLIVMVWITSLAISVPEMVFVQIHQTLDGVWHCYADFGGHATIWKLYLR
FQLNLLGFLLPLLAMIFFYSRIGCVLVRLRPPGQGRALRMAAALVIVFFMLWFPYNLTLFLHSLLDLHVF
GNCEISHRLDYTLQVTESLAFSHCCFTPVLYAFCSHRFRRYLKAFLSVMLRWHQAPGTPSSNHSESSRVT
AQEDVVSMNDLGERQSEDSLNKGEMGNT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_021609
ORF Size 1134 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_021609.4, NP_067622.2
RefSeq Size 2900 bp
RefSeq ORF 1137 bp
Locus ID 59289
UniProt ID O08707
Cytogenetics 9 F4
MW 43.7 kDa
Gene Summary Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Acts as a receptor for chemokines including CCL2, CCL3, CCL3L1, CCL4, CCL5, CCL7, CCL8, CCL11, CCL13, CCL17, CCL22, CCL23, CCL24, SCYA2/MCP-1, SCY3/MIP-1-alpha, SCYA5/RANTES and SCYA7/MCP-3. Upon active ligand stimulation, activates a beta-arrestin 1 (ARRB1)-dependent, G protein-independent signaling pathway that results in the phosphorylation of the actin-binding protein cofilin (CFL1) through a RAC1-PAK1-LIMK1 signaling pathway. Activation of this pathway results in up-regulation of ACKR2 from endosomal compartment to cell membrane, increasing its efficiency in chemokine uptake and degradation. By scavenging chemokines in tissues, on the surfaces of lymphatic vessels, and in placenta, plays an essential role in the resolution (termination) of the inflammatory response and in the regulation of adaptive immune responses. Plays a major role in the immune silencing of macrophages during the resolution of inflammation. Acts as a regulator of inflammatory leukocyte interactions with lymphatic endothelial cells (LECs) and is required for immature/mature dendritic cells discrimination by LECs.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.