Cdk4 (NM_009870) Mouse Tagged ORF Clone

CAT#: MR204246

Cdk4 (Myc-DDK-tagged) - Mouse cyclin-dependent kinase 4 (Cdk4)

Product Images

Circular map for MR204246

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Cdk4
• Synonyms: Crk3
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR204246 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCTGCCACTCGATATGAACCCGTGGCTGAAATTGGTGTCGGTGCCTATGGGACGGTGTACAAAGCCC
  GAGATCCCCACAGTGGCCACTTTGTGGCCCTCAAGAGTGTGAGAGTTCCTAATGGAGGAGCAGCTGGAGG
  GGGCCTTCCCGTCAGCACAGTTCGTGAGGTGGCCTTGTTAAGGAGGCTGGAGGCCTTTGAACATCCCAAT
  GTTGTACGGCTGATGGATGTCTGTGCTACTTCCCGAACTGATCGGGACATCAAGGTCACCCTAGTGTTTG
  AGCATATAGACCAGGACCTGAGGACATACCTGGACAAAGCACCTCCACCGGGCCTGCCGGTTGAGACCAT
  TAAGGATCTAATGCGTCAGTTTCTAAGCGGCCTGGATTTTCTTCATGCAAACTGCATTGTTCACCGGGAC
  CTGAAGCCAGAGAACATTCTAGTGACAAGTAATGGGACCGTCAAGCTGGCTGACTTTGGCCTAGCTAGAA
  TCTACAGCTACCAGATGGCCCTCACGCCTGTGGTGGTTACGCTCTGGTACCGAGCTCCTGAAGTTCTTCT
  GCAGTCTACATACGCAACACCCGTGGACATGTGGAGCGTTGGCTGTATCTTTGCAGAGATGTTCCGTCGG
  AAGCCTCTCTTCTGTGGAAACTCTGAAGCCGACCAGTTGGGGAAAATCTTTGATCTCATTGGATTGCCTC
  CAGAAGACGACTGGCCTCGAGAGGTATCTCTACCTCGAGGAGCCTTTGCCCCCAGAGGGCCTCGGCCAGT
  GCAGTCAGTGGTGCCAGAGATGGAGGAGTCTGGAGCGCAGCTGCTACTGGAAATGCTGACCTTTAACCCA
  CATAAGCGAATCTCTGCCTTCCGAGCCCTGCAGCACTCCTACCTGCACAAGGAGGAAAGCGACGCAGAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR204246 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALLRRLEAFEHPN
  VVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDFLHANCIVHRD
  LKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRR
  KPLFCGNSEADQLGKIFDLIGLPPEDDWPREVSLPRGAFAPRGPRPVQSVVPEMEESGAQLLLEMLTFNP
  HKRISAFRALQHSYLHKEESDAE
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_009870
• ORF Size: 912 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_009870.4
• RefSeq Size: 1365 bp
• RefSeq ORF: 912 bp
• Locus ID: 12567
• UniProt ID: P30285
• Cytogenetics: 10 D3
• MW: 33.8 kDa
• Gene Summary: Ser/Thr-kinase component of cyclin D-CDK4 (DC) complexes that phosphorylate and inhibit members of the retinoblastoma (RB) protein family including RB1 and regulate the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complexes and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also phosphorylates SMAD3 in a cell-cycle-dependent manner and represses its transcriptional activity. Component of the ternary complex, cyclin D/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex (By similarity).[UniProtKB/Swiss-Prot Function]