Sln (NM_025540) Mouse Tagged ORF Clone
CAT#: MR200004
- TrueORF®
Sln (Myc-DDK-tagged) - Mouse sarcolipin (Sln)
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_025540" in other vectors (4)
Interest in protein/lysate? Submit request here!
USD 198.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Sln |
Synonyms | 2310045A07Rik |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200004 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGAGGTCTACTCAGGAGCTGTTTATCAACTTCACAGTTGTCCTCATCACCGTTCTCCTTATGTGGC TCCTCGTGAGGTCCTACCAATAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200004 protein sequence
Red=Cloning site Green=Tags(s) MERSTQELFINFTVVLITVLLMWLLVRSYQY myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_025540 |
ORF Size | 96 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_025540.2, NP_079816.1 |
RefSeq Size | 536 bp |
RefSeq ORF | 96 bp |
Locus ID | 66402 |
UniProt ID | Q9CQD6 |
Cytogenetics | 9 A5.3 |
MW | 3.8 kDa |
Gene Summary | Sarcoplasmic reticulum Ca(2+)-ATPases are transmembrane proteins that catalyze the ATP-dependent transport of Ca(2+) from the cytosol into the lumen of the sarcoplasmic reticulum in muscle cells. This gene encodes a small proteolipid that regulates several sarcoplasmic reticulum Ca(2+)-ATPases. The transmembrane protein interacts with Ca(2+)-ATPases and reduces the accumulation of Ca(2+) in the sarcoplasmic reticulum without affecting the rate of ATP hydrolysis. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC204674 | Sln (untagged) - Mouse sarcolipin (Sln), (10ug) |
USD 150.00 |
|
MG200004 | Sln (tGFP-tagged) - Mouse sarcolipin (Sln) |
USD 350.00 |
|
MR200004L3 | Lenti ORF clone of Sln (Myc-DDK-tagged) - Mouse sarcolipin (Sln) |
USD 450.00 |
|
MR200004L4 | Lenti ORF clone of Sln (mGFP-tagged) - Mouse sarcolipin (Sln) |
USD 450.00 |
{0} Product Review(s)
Be the first one to submit a review