Pigyl (NM_001082532) Mouse Tagged ORF Clone

CAT#: MG217923

  • TrueORF®

Pigyl (tGFP-tagged) - Mouse phosphatidylinositol glycan anchor biosynthesis class Y-like (Pigyl), (10ug)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_001082532" in other vectors (4)

Reconstitution Protocol

USD 365.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "Pigyl"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Pigyl
Synonyms 1810008A14Rik; PIG-Y; Pigy
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG217923 representing NM_001082532
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCCGGTCCCTGCCCACCATGACCGTCCTCATCCCACTGGTCTCGCTGGCAGGCCTGCTCTACTCCG
CCTCCGTGGAGGAAGGCTTCCCAGAGGGCTGCACCAGCGCCAGCAGCCTGTGCTTCTACAGCTTGCTCTT
GCCGGTCACCGTGCCTGTGTACGTGTTCTTCCATCTGTGGACATGGATGGGCCTGAAGCTCTTCAGACAT
AAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG217923 representing NM_001082532
Red=Cloning site Green=Tags(s)

MIRSLPTMTVLIPLVSLAGLLYSASVEEGFPEGCTSASSLCFYSLLLPVTVPVYVFFHLWTWMGLKLFRH
N

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001082532
ORF Size 213 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001082532.1, NP_001076001.1
RefSeq Size 692 bp
RefSeq ORF 216 bp
Locus ID 66268
UniProt ID P0C1P0
Cytogenetics 9 A3
Gene Summary This gene encodes a homolog of a human protein that functions in glycosylphosphatidylinositol biosynthesis. The human protein is expressed from an unusual locus that encodes two distinct proteins in upstream and downstream CDSes; however, in mouse these two proteins are expressed from distinct loci. The product of this locus is highly similar to the protein expressed from the human downstream CDS. A separate mouse locus on chromosome 6 is orthologous to the human locus and encodes a protein similar to the human protein expressed from the upstream CDS. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.