Vegfc (NM_009506) Mouse Tagged ORF Clone
CAT#: MG206551
- TrueORF®
Vegfc (tGFP-tagged) - Mouse vascular endothelial growth factor C (Vegfc)
ORF Plasmid: DDK
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_009506" in other vectors (4)
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | TurboGFP |
Symbol | Vegfc |
Synonyms | AW228853; VEGF-C |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MG206551 representing NM_009506
Red=Cloning site Green=Tags(s) MHLLCFLSLACSLLAAALIPSPREAPATVAAFESGLGFSEAEPDGGEVKAFEGKDLEEQLRSVSSVDELM SVLYPDYWKMYKCQLRKGGWQQPTLNTRTGDSVKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEF GAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSK LDVYRQVHSIIRRSLPATLPQCQAANKTCPTNYVWNNYMCRCLAQQDFIFYSNVEDDSTNGFHDVCGPNK ELDEDTCQCVCKGGLRPSSCGPHKELDRDSCQCVCKNKLFPNSCGANREFDENTCQCVCKRTCPRNQPLN PGKCACECTENTQKCFLKGKKFHHQTCSCYRRPCANRLKHCDPGLSFSEEVCRCVPSYWKRPHLN TRTRPLE - GFP Tag - V |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_009506 |
ORF Size | 1245 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_009506.2, NP_033532.1 |
RefSeq Size | 1881 bp |
RefSeq ORF | 1248 bp |
Locus ID | 22341 |
UniProt ID | P97953 |
Cytogenetics | 8 B1.3 |
Gene Summary | Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates KDR/VEGFR2 and FLT4/VEGFR3 receptors.[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC207442 | Vegfc (untagged) - Mouse vascular endothelial growth factor C (Vegfc), (10ug) |
USD 457.00 |
|
MR206551 | Vegfc (Myc-DDK-tagged) - Mouse vascular endothelial growth factor C (Vegfc) |
USD 457.00 |
|
MR206551L3 | Lenti ORF clone of Vegfc (Myc-DDK-tagged) - Mouse vascular endothelial growth factor C (Vegfc) |
USD 757.00 |
|
MR206551L4 | Lenti ORF clone of Vegfc (mGFP-tagged) - Mouse vascular endothelial growth factor C (Vegfc) |
USD 757.00 |
{0} Product Review(s)
Be the first one to submit a review