TNFAIP3 Rabbit Polyclonal Antibody
USD 200.00
USD 867.00
USD 665.00
Specifications
Product Data | |
Applications | IHC |
Reactivities | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence LGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRP |
Specificity | Expected reactivity: Cow, Dog, Horse, Human, Mouse, Rabbit, Rat Homology: Cow: 77%; Dog: 77%; Horse: 85%; Human: 100%; Mouse: 83%; Rabbit: 100%; Rat: 83% |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Stability | Shelf life: one year from despatch. |
Predicted Protein Size | 90 kDa |
Gene Name | TNF alpha induced protein 3 |
Database Link | |
Background | This gene was identified as a gene whose expression is rapidly induced by the tumor necrosis factor (TNF). The protein encoded by this gene is a zinc finger protein and ubiqitin-editing enzyme, and has been shown to inhibit NF-kappa B activation as well as TNF-mediated apoptosis. The encoded protein, which has both ubiquitin ligase and deubiquitinase activities, is involved in the cytokine-mediated immune and inflammatory responses. Several transcript variants encoding the same protein have been found for this gene. |
Synonyms | A20; MGC104522; MGC138687; MGC138688; OTUD7C; TNFA1P2 |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | NOD-like receptor signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review