IRF7 Rabbit Polyclonal Antibody

CAT#: TA343439

Rabbit Polyclonal Anti-IRF7 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human interferon regulatory factor 7 (IRF7), transcript variant a, 20 µg
    • 20 ug

USD 867.00


Transient overexpression lysate of interferon regulatory factor 7 (IRF7), transcript variant a
    • 100 ug

USD 665.00

Other products for "IRF7"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-IRF7 antibody: synthetic peptide directed towards the middle region of human IRF7. Synthetic peptide located within the following region: EPWLCRVHLEGTQREGVSSLDSSSLSLCLSSANSLYDDIECFLMELEQPA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 56 kDa
Gene Name interferon regulatory factor 7
Background IRF7 is interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. IRF7 has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain genes.
Synonyms IMD39; IRF-7H; IRF7A; IRF7B; IRF7C; IRF7H
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Horse: 92%; Rabbit: 92%; Pig: 85%; Bovine: 85%
Reference Data
Protein Families Transcription Factors
Protein Pathways Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.