IRF7 Rabbit Polyclonal Antibody
USD 200.00
USD 867.00
USD 665.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-IRF7 antibody: synthetic peptide directed towards the middle region of human IRF7. Synthetic peptide located within the following region: EPWLCRVHLEGTQREGVSSLDSSSLSLCLSSANSLYDDIECFLMELEQPA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 56 kDa |
Gene Name | interferon regulatory factor 7 |
Database Link | |
Background | IRF7 is interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. IRF7 has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain genes. |
Synonyms | IMD39; IRF-7H; IRF7A; IRF7B; IRF7C; IRF7H |
Note | Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Horse: 92%; Rabbit: 92%; Pig: 85%; Bovine: 85% |
Reference Data | |
Protein Families | Transcription Factors |
Protein Pathways | Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review