HLA DP (HLA-DPA1) Rabbit Polyclonal Antibody

CAT#: TA342062

Rabbit Polyclonal Anti-HLA-DPA1 Antibody

Product Images

WB Suggested Anti-HLA-DPA1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HLA-DPA1 antibody: synthetic peptide directed towards the middle region of human HLA-DPA1. Synthetic peptide located within the following region: EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: major histocompatibility complex, class II, DP alpha 1
• Database Link:
  NP_291032
  Entrez Gene 3113 Human
  UniProt ID P20036
• Background: The specific function ofThis protein remains unknown.HLA-DPA1 belongs toThe HLA class II alpha chain paralogues.This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta (DPB) chain, both anchored inThe membrane. It plays a central role inThe immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages).The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon one encodesThe leader peptide, exons 2 and 3 encodeThe two extracellular domains, exon 4 encodesThe transmembrane domain andThe cytoplasmic tail. WithinThe DP molecule bothThe alpha chain andThe beta chain containThe polymorphisms specifyingThe peptide binding specificities, resulting in up to 4 different molecules. Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Entrez Gene record to access additional publications.
• Synonyms: DP(W3); DP(W4); HLA-DP1A; HLADP; HLASB; PLT1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Allograft rejection, Antigen processing and presentation, Asthma, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Graft-versus-host disease, Systemic lupus erythematosus, Type I diabetes mellitus, Viral myocarditis