TEX264 Rabbit Polyclonal Antibody

CAT#: TA341988

Rabbit Polyclonal Anti-TEX264 Antibody

Product Images

WB Suggested Anti-TEX264 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: COLO205 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TEX264 antibody: synthetic peptide directed towards the middle region of human TEX264. Synthetic peptide located within the following region: SIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: testis expressed 264
• Database Link:
  NP_057010
  Entrez Gene 51368 Human
  UniProt ID Q9Y6I9
• Background: The specific function of TEX264 is not yet known.
• Synonyms: ZSIG11
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Bovine: 93%

Reference Data

• Protein Families: Secreted Protein, Transmembrane