Thyroid Hormone Receptor beta (THRB) Rabbit Polyclonal Antibody

CAT#: TA341821

Rabbit Polyclonal Anti-Thrb Antibody

Product Images

WB Suggested Anti-Thrb Antibody Titration: 1.25 ug/ml; Positive Control: SP2/0 cell lysate

• 

  Application:ChIP; Sample Type: mouse liver tissue; Chromatin Used: 100ug tissue; Antibody Used: 10ug ; Image Submitted by: Joanna DiSpirito; University of Pennsylvania; ;

• 

  Application:ChIP; Sample Type: mouse liver tissue; Chromatin Used: 100ug tissue; Antibody Used: 10ug ; Image Submitted by: Joanna DiSpirito; University of Pennsylvania; ;

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB, ChIP
• Reactivities: Mouse, Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Thrb antibody: synthetic peptide directed towards the N terminal of mouse Thrb. Synthetic peptide located within the following region: KSKDSDLDMALSQSSQPAHLPEEKPFPQVQSPPHSQKKGYIPSYLDKDEL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: thyroid hormone receptor beta
• Database Link:
  NP_000452
  Entrez Gene 21834 MouseEntrez Gene 7068 Human
  UniProt ID P10828
• Background: Nuclear hormone receptor that can act as a repressor or activator of transcription. High affinity receptor for thyroid hormones, including triiodothyronine and thyroxine.
• Synonyms: C-ERBA-2; C-ERBA-BETA; ERBA2; GRTH; NR1A2; PRTH; THR1; THRB1; THRB2
• Note: Immunogen Sequence Homology: Mouse: 100%; Pig: 90%; Rat: 90%; Horse: 90%; Human: 90%; Bovine: 90%; Guinea pig: 90%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
• Protein Pathways: Neuroactive ligand-receptor interaction