Activin A Receptor Type IC (ACVR1C) Rabbit Polyclonal Antibody

CAT#: TA340402

Rabbit Polyclonal Anti-ACVR1C Antibody

Product Images

WB Suggested Anti-ACVR1C Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACVR1C antibody: synthetic peptide directed towards the N terminal of human ACVR1C. Synthetic peptide located within the following region: QVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: activin A receptor type 1C
• Database Link:
  NP_660302
  Entrez Gene 130399 Human
  UniProt ID Q8NER5
• Background: ACVR1C is a type I receptor for the TGFB family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors.ACVR1C is a type I receptor for the TGFB (see MIM 190180) family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors (Bondestam et al., 2001 [PubMed 12063393]). [supplied by OMIM]
• Synonyms: ACVRLK7; ALK7
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Rat: 86%; Dog: 83%; Pig: 81%; Guinea pig: 80%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase, Transmembrane
• Protein Pathways: Adherens junction, Chronic myeloid leukemia, Colorectal cancer, Endocytosis, MAPK signaling pathway, Pancreatic cancer, Pathways in cancer, TGF-beta signaling pathway