CYP11A1 Rabbit Polyclonal Antibody

CAT#: TA339994

Rabbit Polyclonal Anti-CYP11A1 Antibody

Product Images

5Hum. Fetal Liver; Host: Rabbit; Target Name: FAM46C; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• 

  CYP11A1 antibody - middle region validated by WB using Hela cell lysate at 1 ug/ml.CYP11A1 is supported by BioGPS gene expression data to be expressed in HeLa

• 

  7Human Hela; Host: Rabbit; Target Name: EGFL8; Sample Tissue: Hela; Antibody Dilution: 1.0 ug/ml CYP11A1 is supported by BioGPS gene expression data to be expressed in HeLa

• 

  Immunohistochemistry with Human Placenta lysate tissue at an antibody concentration of 5.0 ug/ml using anti-CYP11A1 antibody

• 

  Immunohistochemistry with HK2 cell lysate tissue

• 

  Immunohistochemistry with HK2 cell lysate tissue

• Immunohistochemistry with HK2 cell lysate tissue

Show all 7 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CYP11A1 antibody: synthetic peptide directed towards the middle region of human CYP11A1. Synthetic peptide located within the following region: LRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: cytochrome P450 family 11 subfamily A member 1
• Database Link:
  NP_000772
  Entrez Gene 1583 Human
  UniProt ID P05108
• Background: CYP11A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. CYP11A1 localizes to the mitochondrial inner membrane and catalyzes the conversion of cholesterol to pregnenolone, the first and rate-limiting step in the synthesis of the steroid hormones. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and catalyzes the conversion of cholesterol to pregnenolone, the first and rate-limiting step in the synthesis of the steroid hormones. Two transcript variants encoding different isoforms have been found for this gene. The cellular location of the smaller isoform is unclear since it lacks the mitochondrial-targeting transit peptide.
• Synonyms: CYP11A; CYPXIA1; P450SCC
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, P450
• Protein Pathways: C21-Steroid hormone metabolism, Metabolic pathways