CBR1 Rabbit Polyclonal Antibody

CAT#: TA338913

Rabbit Polyclonal Anti-CBR1 Antibody

Product Images

WB Suggested Anti-CBR1 Antibody Titration: 0.2-1 ug/ml; Positive Control: OVCAR-3 cell lysate.CBR1 is supported by BioGPS gene expression data to be expressed in OVCAR3

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CBR1 antibody: synthetic peptide directed towards the middle region of human CBR1. Synthetic peptide located within the following region: AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: carbonyl reductase 1
• Database Link:
  NP_001748
  Entrez Gene 873 Human
  UniProt ID P16152
• Background: The protein encoded by this gene belongs to the short-chain dehydrogenases/reductases (SDR) family, which function as NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds, such as quinones, prostaglandins, and various xenobiotics. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2013]
• Synonyms: CBR; hCBR1; SDR21C1
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Rabbit: 79%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Arachidonic acid metabolism, Metabolic pathways