CNPase (CNP) Rabbit Polyclonal Antibody

CAT#: TA334680

Rabbit Polyclonal Anti-CNP Antibody


USD 485.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of 2',3'-cyclic nucleotide 3' phosphodiesterase (CNP)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human 2',3'-cyclic nucleotide 3' phosphodiesterase (CNP), 20 µg
    • 20 ug

USD 867.00

Other products for "CNPase"

Specifications

Product Data
Applications IP, WB
Recommended Dilution WB, IP
Reactivities Human, Rat, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CNP antibody: synthetic peptide directed towards the N terminal of human CNP. Synthetic peptide located within the following region: YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 45 kDa
Gene Name 2',3'-cyclic nucleotide 3' phosphodiesterase
Background 2',3'-Cyclic nucleotide-3'-phosphodiesterase (CNP1 and CNP2) is the major enzyme of central nervous system myelin. It is associated with oligodendroglial plasma membrane and uncompacted myelin (myelin-like fraction), which are in contact with glial cytoplasm
Synonyms CNP1
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Sheep: 100%; Dog: 92%; Pig: 92%; Bovine: 85%; Rat: 77%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.