CNPase (CNP) Rabbit Polyclonal Antibody
USD 436.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | IP, WB |
Recommended Dilution | WB, IP |
Reactivities | Human, Rat, Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CNP antibody: synthetic peptide directed towards the N terminal of human CNP. Synthetic peptide located within the following region: YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 45 kDa |
Gene Name | 2',3'-cyclic nucleotide 3' phosphodiesterase |
Database Link | |
Background | 2',3'-Cyclic nucleotide-3'-phosphodiesterase (CNP1 and CNP2) is the major enzyme of central nervous system myelin. It is associated with oligodendroglial plasma membrane and uncompacted myelin (myelin-like fraction), which are in contact with glial cytoplasm |
Synonyms | CNP1 |
Note | Immunogen Sequence Homology: Horse: 100%; Human: 100%; Sheep: 100%; Dog: 92%; Pig: 92%; Bovine: 85%; Rat: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review