Isoleucyl tRNA synthetase (IARS) Rabbit Polyclonal Antibody

CAT#: TA334484

Rabbit Polyclonal Anti-IARS Antibody

Product Images

WB Suggested Anti-IARS Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: COLO205 cell lysateIARS is supported by BioGPS gene expression data to be expressed in COLO205

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IARS antibody: synthetic peptide directed towards the N terminal of human IARS. Synthetic peptide located within the following region: SKHKPKFTFYDGPPFATGLPHYGHILAGTIKDIVTRYAHQSGFHVDRRFG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 144 kDa
• Gene Name: isoleucyl-tRNA synthetase
• Database Link:
  NP_038203
  Entrez Gene 3376 Human
  UniProt ID P41252
• Background: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Isoleucine-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family and has been identified as a target of autoantibodies in the autoimmune disease polymyositis/dermatomyositis. Alternatively spliced transcript variants have been found. [provided by RefSeq, Nov 2012]
• Synonyms: IARS1; ILERS; ILRS; IRS; PRO0785
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Yeast: 100%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 86%; Horse: 86%; Mouse: 86%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Aminoacyl-tRNA biosynthesis, Valine, leucine and isoleucine biosynthesis