TCF7L2 Rabbit Polyclonal Antibody
Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Transient overexpression lysate of transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 1
USD 436.00
Other products for "TCF7L2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the middle region of human TCF7L2. Synthetic peptide located within the following region: GGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQES |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 65 kDa |
Gene Name | transcription factor 7 like 2 |
Database Link | |
Background | The TCL7L2 is a high mobility group (HMG) box-containing transcription factor implicated in blood glucose homeostasis. The study of Yi et al. suggested that TCL7L2 acts through regulation of proglucagon through repression of the proglucagon gene in enteroendocrine cells via the Wnt signaling pathway. The TCL7L2 gene product is a high mobility group (HMG) box-containing transcription factor implicated in blood glucose homeostasis. The study of Yi et al. (2005) [PubMed 15525634] suggested that TCL7L2 acts through regulation of proglucagon (MIM 138030) through repression of the proglucagon gene in enteroendocrine cells via the Wnt signaling pathway. [supplied by OMIM]. Sequence Note: This gene (TCF7L2, alias TCF-4) is distinct from TCF4. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-202 DA473655.1 1-202 203-251 Y11306.2 3-51 252-1252 AK225809.1 256-1256 1253-1305 Y11306.2 1053-1105 1306-1756 AK225809.1 1310-1760 1757-1811 Y11306.2 1557-1611 1812-2652 AK225809.1 1765-2605 |
Synonyms | TCF-4; TCF4 |
Note | Immunogen sequence homology: Dog: 92%; Pig: 92%; Rat: 92%; Horse: 92%; Human: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Zebrafish: 92%; Guinea pig: 92% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Acute myeloid leukemia, Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Basal cell carcinoma, Colorectal cancer, Endometrial cancer, Melanogenesis, Pathways in cancer, Prostate cancer, Thyroid cancer, Wnt signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.