MRP2 (ABCC2) Rabbit Polyclonal Antibody

CAT#: TA332361

Rabbit Polyclonal Anti-Abcc2 Antibody

Product Images

WB Suggested Anti-Abcc2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Mouse Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Abcc2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TIQDVNLDIKPGQLVAVVGTVGSGKSSLISAMLGEMENVHGHITIKGSIA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 174 kDa
• Gene Name: ATP binding cassette subfamily C member 2
• Database Link:
  NP_000383
  Entrez Gene 12780 Mouse
  UniProt ID Q92887
• Background: Abcc2 mediates hepatobiliary excretion of numerous organic anions. Abcc2 may function as a cellular cisplatin transporter.
• Synonyms: ABC30; CMOAT; cMRP; DJS; MRP2
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Dog: 86%; Mouse: 86%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: ABC transporters