ABCD4 Rabbit Polyclonal Antibody

CAT#: TA332078

Rabbit Polyclonal Anti-ABCD4 Antibody

Product Images

WB Suggested Anti-ABCD4 Antibody Titration: 1.25ug/ml; Positive Control: HepG2 cell lysate; ABCD4 is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ABCD4 Antibody: synthetic peptide directed towards the C terminal of human ABCD4. Synthetic peptide located within the following region: FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: ATP binding cassette subfamily D member 4
• Database Link:
  NP_005041
  Entrez Gene 5826 Human
  UniProt ID O14678
• Background: ABCD4 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. The function of this peroxisomal membrane protein is unknown. However, it is speculated that it may function as a heterodimer for another peroxisomal ABC transporter and, therefore, may modify the adrenoleukodystrophy phenotype. It may also play a role in the process of peroxisome biogenesis.
• Synonyms: ABC41; EST352188; MAHCJ; P70R; P79R; PMP69; PXMP1L
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Yeast: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: ABC transporters