OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
Home Antibody Antitag Antibodies

Mouse Monoclonal anti-IT6 antibody

div

Specifications Citations Customer Reviews Product Documents
SKU Description Datasheet Price Availability  
TA100032 Mouse Monoclonal anti-IT6 antibody $400 3 days Add to Shopping Cart
Conjugation is available for this antibody: choose conjugation type
Write Review & Get Rewarded
X

Write a review and get rewarded!

Review this antibody and earn an OriGene coupon or Amazon giftcard

Follow these easy steps to reward yourself:

  1. Sign in to your account, or register for a new account;
  2. Write a review;
  3. Receive a coupon or giftcard once your review is accepted.

Click the button to start writing a review


Specification

Product NameMouse Monoclonal anti-IT6 antibody
See all IT6 Antibodies >>
Clone NameIT6-1 (R19/4 11/15)
IsoTypeIgG2b kappa
Concentration1.5mg/mL
ImmunogenPurified recombinant peptide EQCGRQAGGKLCPDNLCCSQWGWCGSTDEYCSPDHNCQSNCKD produced in E. coli
Host SpeciesMouse
FormulationPBS pH 7,4
ReactivityHevea brasiliensis
Validated ApplicationWB: 1/500-1/4000
Suggested DilutionWB: 1/500-1/4000
Predicted Size4,7 kDa
Storage/Stability-20
WB Image
HEK293T cells were transfected with the pCMV6-AC-IT6-RFP (PS100099 with RFP to express RFP-IT6 fusion protein, Left lane) or pCMV6-AN-IT6-RFP (PS100096 with RFP to express IT6-RFP fusion protein, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (10 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-IT6 antibody (TA100032) at 1:1000 dilution.

 

bar
Inc 5000 Healthcare Company