Oaz3 (NM_001101018) Rat Tagged ORF Clone

CAT#: RR215944

  • TrueORF®

Oaz3 (myc-DDK-tagged) - Rat ornithine decarboxylase antizyme 3 (Oaz3)


  "NM_001101018" in other vectors (1)

Reconstitution Protocol

USD 330.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Oaz3"

Specifications

Product Data
Type Rat Tagged ORF Clone
Tag Myc-DDK
Symbol Oaz3
Synonyms Az3; Oaz-t; ODC-Az 3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RR215944 representing NM_001101018
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

CTGCCTTGTACCAGGTCCCGCCCCTCTCTCTACTCCCTTTCTTATATTAAGAGGGGAAAAACACGGAACT
GCCTCTACCCATTCTGGTCACCATACGCCTATTACCTCTACTGTTACAAATACCGGATCACCCTCCGGGA
GAAGATGCTGCCTTGTTGTTACAGAAGCATCACTTACAAGGAACAGGAGGACCTGACTCTCCGGCCCCAT
TGCTGCCTCCCGTGCTCCTGCCTCCCGTACTCCTGCCTCCCGTGCTCCCTGCCTTGTACCAGGTCCCGCC
CCTCTCTCTACTCCCTTTCTTATATTAAGAGGGGAAAAACACGGAACTGCCTCTACCCATTCTGGTCACC
ATACGCCTATTACCTCTACTGTTACAAATACCGGATCACCCTCCGGGAGAAGATGCTGCCTTGTTGTTAC
AGAAGCATCACTTACAAGGAACAGGAGGACCTGACTCTCCGGCCCCATTGCTGCCTCCCGTGCTCCTGCC
TCCCGTACTCCTGCCTCCCGTGCTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR215944 representing NM_001101018
Red=Cloning site Green=Tags(s)

LPCTRSRPSLYSLSYIKRGKTRNCLYPFWSPYAYYLYCYKYRITLREKMLPCCYRSITYKEQEDLTLRPH
CCLPCSCLPYSCLPCSLPCTRSRPSLYSLSYIKRGKTRNCLYPFWSPYAYYLYCYKYRITLREKMLPCCY
RSITYKEQEDLTLRPHCCLPCSCLPYSCLPCS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001101018
ORF Size 513 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001101018.1, NP_001094488.1
RefSeq Size 878 bp
RefSeq ORF 733 bp
Locus ID 689588
Cytogenetics 2q34
MW 20.7 kDa
Gene Summary The protein encoded by this gene belongs to the ornithine decarboxylase antizyme family, which plays a role in cell growth and proliferation by regulating intracellular polyamine levels. Expression of antizymes requires +1 ribosomal frameshifting, which is enhanced by high levels of polyamines. Antizymes in turn bind to and inhibit ornithine decarboxylase (ODC), the key enzyme in polyamine biosynthesis; thus, completing the auto-regulatory circuit. This gene encodes antizyme 3, the third member of the antizyme family. Like antizymes 1 and 2, antizyme 3 inhibits ODC activity and polyamine uptake; however, it does not stimulate ODC degradation. Also, while antizymes 1 and 2 have broad tissue distribution, expression of antizyme 3 is restricted to haploid germ cells in testis, suggesting a distinct role for this antizyme in spermiogenesis. Antizyme 3 gene knockout studies showed that homozygous mutant male mice were infertile, and indicated the likely role of this antizyme in the formation of a rigid connection between the sperm head and tail during spermatogenesis. This transcript initiates translation from a non-AUG (CUG) codon that is highly conserved among the antizyme 3 orthologs. [provided by RefSeq, Dec 2014]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.