Argonaute 2 (AGO2) (NM_001164623) Human Recombinant Protein

CAT#: TP328592

Purified recombinant protein of Homo sapiens eukaryotic translation initiation factor 2C, 2 (EIF2C2), transcript variant 2, 20 µg

Product Images

Processing of pre-miR-130b by recombinant Dicer and AGO2 proteins in vitro. Twenty pmol of pre-miR-130b was incubated with 2 U of Dicer or 200 ng of Ago2 (OriGene TP328592) for four hours. The processed products were detected using Northern blotting with a biotin-labeled anti-miR-130b probe. Lane 1: 22 nt biotin-ssRNA; 2: pre-miR-130b; 3: pre-miR-130b with Dicer; 4: pre-miR-130b with AGO2. Figure cited from Sci Rep, PMID: 28769054

• 

  Coomassie blue staining of purified AGO2 protein (Cat# TP328592). The protein was produced from HEK293T cells transfected with AGO2 cDNA clone (Cat# RC228592) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC228592 representing NM_001164623
  Red=Cloning site Green=Tags(s)
  
  MYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELDIKPEKCPRRV
  NREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKDRIFKVSIKWVSCVSL
  QALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPSL
  WKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYR
  VCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQ
  RCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILY
  GGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPC
  FCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTL
  SNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVR
  VQQHRQEIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQP
  GITFIVVQKRHHTRLFCTDKNERGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAY
  YAHLVAFRARYHLVDKEHDSAEGSHTSGQSNGRDHQALAKAVQVHQDTLRTMYFA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 93.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: Enzyme activity (PMID: 28769054)
• Preparation: NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001158095
• Locus ID: 27161
• UniProt ID: Q9UKV8
• Cytogenetics: 8q24.3
• Refseq ORF: 2475
• Synonyms: CASC7; EIF2C2; LESKRES; LINC00980; PPD; Q10
• Summary: This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]
• Protein Families: Druggable Genome