TSH Receptor (TSHR) (NM_001142626) Human Recombinant Protein

CAT#: TP326653

Purified recombinant protein of Homo sapiens thyroid stimulating hormone receptor (TSHR), transcript variant 3, 20 µg

Product Images

Coomassie blue staining of purified TSHR protein (Cat# TP326653). The protein was produced from HEK293T cells transfected with TSHR cDNA clone (Cat# RC226653) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC226653 representing NM_001142626
  Red=Cloning site Green=Tags(s)
  
  MRPADLLQLVLLLDLPRDLGGMGCSSPPCECHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSH
  AFSNLPNISRIYVSIDVTLQQLESHSFYNLSKVTHIEIRNTRNLTYIDPDALKELPLLKFLGIFNTGLKM
  FPDLTKVYSTDIFFILEITDNPYMTSIPVNAFQGLCNETLTLKLYNNGFTSVQGYAFNGTKLDAVYLNKN
  KYLTVIDKDAFGGVYSGPSLLVENVAVSGKGFCKSLFSWLYRLPLGRKSLSFETQKAPRSSMPS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001136098
• Locus ID: 7253
• UniProt ID: P16473
• Cytogenetics: 14q31.1
• Refseq ORF: 822
• Synonyms: CHNG1; hTSHR-I; LGR3
• Summary: The protein encoded by this gene is a membrane protein and a major controller of thyroid cell metabolism. The encoded protein is a receptor for thyrothropin and thyrostimulin, and its activity is mediated by adenylate cyclase. Defects in this gene are a cause of several types of hyperthyroidism. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008]
• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Autoimmune thyroid disease, Neuroactive ligand-receptor interaction