RASGRP2 (NM_153819) Human Recombinant Protein
CAT#: TP317525
Recombinant protein of human RAS guanyl releasing protein 2 (calcium and DAG-regulated) (RASGRP2), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217525 protein sequence
Red=Cloning site Green=Tags(s) MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNS LQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIDSVPTYKWKRQVTQRNPVG QKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHSFVTHGCTVDNPVLERFISLFNSVSQWVQLM ILSKPTAPQRALVITHFVHVAEKLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELV TATGNYGNYRRRLAACVGFRFPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSL RPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQ ALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEMVSYFLRSSSV LGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCKDRLSVECRRRAQSVSLEGS APSPSPMHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTVEDGVFDIHL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 69.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_722541 |
Locus ID | 10235 |
UniProt ID | Q7LDG7 |
Cytogenetics | 11q13.1 |
Refseq Size | 2310 |
Refseq ORF | 1827 |
Synonyms | CALDAG-GEFI; CDC25L |
Summary | The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain. This protein can activate small GTPases, including RAS and RAP1/RAS3. The nucleotide exchange activity of this protein can be stimulated by calcium and diacylglycerol. Four alternatively spliced transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jan 2016] |
Protein Pathways | Chemokine signaling pathway, MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406966 | RASGRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC420662 | RASGRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC420663 | RASGRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY406966 | Transient overexpression lysate of RAS guanyl releasing protein 2 (calcium and DAG-regulated) (RASGRP2), transcript variant 2 |
USD 665.00 |
|
LY420662 | Transient overexpression lysate of RAS guanyl releasing protein 2 (calcium and DAG-regulated) (RASGRP2), transcript variant 3 |
USD 665.00 |
|
LY420663 | Transient overexpression lysate of RAS guanyl releasing protein 2 (calcium and DAG-regulated) (RASGRP2), transcript variant 4 |
USD 665.00 |
|
PH312672 | RASGRP2 MS Standard C13 and N15-labeled recombinant protein (NP_001092140) |
USD 3,255.00 |
|
PH312719 | RASGRP2 MS Standard C13 and N15-labeled recombinant protein (NP_001092141) |
USD 3,255.00 |
|
PH317525 | RASGRP2 MS Standard C13 and N15-labeled recombinant protein (NP_722541) |
USD 3,255.00 |
|
TP312672 | Recombinant protein of human RAS guanyl releasing protein 2 (calcium and DAG-regulated) (RASGRP2), transcript variant 3, 20 µg |
USD 867.00 |
|
TP312719 | Recombinant protein of human RAS guanyl releasing protein 2 (calcium and DAG-regulated) (RASGRP2), transcript variant 4, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review