DRIL1 (ARID3A) (NM_005224) Human Recombinant Protein

CAT#: TP309254

Recombinant protein of human AT rich interactive domain 3A (BRIGHT-like) (ARID3A), 20 µg

Product Images

Coomassie blue staining of purified ARID3A protein (Cat# TP309254). The protein was produced from HEK293T cells transfected with ARID3A cDNA clone (Cat# RC209254) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209254 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLQAVMETLLQRQQRARQELEARQQLPPDPPAAPHGRARAAPDEDREPESARMQRAQMAALAAMRAAAA
  GLGHPASPGGSEDGPPGSEEEDAAREGTPGSPGRGREGPGEEHFEDMASDEDMKPKWEEEEMEEDLGEDE
  EEEEEDYEDEEEEEDEEGLGPPGPASLGTTALFPRKAQPPQAFRGDGVPRVLGGQERPGPGPAHPGGAAH
  VAPQLQPPDHGDWTYEEQFKQLYELDGDPKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVT
  EKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMEYLYPYECEKRGLSNPNELQAAIDSNRREGR
  RQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVSLAGH
  PVVAAQAAAVQAAAAQAAVAAQAAALEQLREKLESAEPPEKKMALVADEQQRLMQRALQQNFLAMAAQLP
  MSIRINSQASESRQDSAVNLTGTNGSNSISMSVEINGIMYTGVLFAQPPAPTPTSAPNKGGGGGGSSSSN
  AGGRGGNTGTSGGQAGPAGLSTPSTSTSNNSLP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 62.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005215
• Locus ID: 1820
• UniProt ID: Q99856
• Cytogenetics: 19p13.3
• Refseq Size: 2823
• Refseq ORF: 1779
• Synonyms: BRIGHT; DRIL1; DRIL3; E2FBP1
• Summary: This gene encodes a member of the ARID (AT-rich interaction domain) family of DNA binding proteins. It was found by homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation, and possibly in chromatin structure modification. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors