MRCL3 (MYL12A) (NM_006471) Human Recombinant Protein

CAT#: TP307294

Recombinant protein of human myosin, light chain 12A, regulatory, non-sarcomeric (MYL12A), 20 µg

Product Images

Coomassie blue staining of purified MYL12A protein (Cat# TP307294). The protein was produced from HEK293T cells transfected with MYL12A cDNA clone (Cat# RC207294) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207294 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLD
  AMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDE
  LYREAPIDKKGNFNYIEFTRILKHGAKDKDD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006462
• Locus ID: 10627
• UniProt ID: P19105
• Cytogenetics: 18p11.31
• Refseq Size: 1243
• Refseq ORF: 513
• Synonyms: HEL-S-24; MLC-2B; MLCB; MRCL3; MRLC3; MYL2B
• Summary: This gene encodes a nonsarcomeric myosin regulatory light chain. This protein is activated by phosphorylation and regulates smooth muscle and non-muscle cell contraction. This protein may also be involved in DNA damage repair by sequestering the transcriptional regulator apoptosis-antagonizing transcription factor (AATF)/Che-1 which functions as a repressor of p53-driven apoptosis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8.[provided by RefSeq, Dec 2014]
• Protein Pathways: Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction