Pigyl (BC025114) Mouse Tagged ORF Clone
CAT#: MR200384
- TrueORF®
(Myc-DDK-tagged) - Mouse cDNA clone MGC:35756 IMAGE:4925089
ORF Plasmid: tGFP
"BC025114" in other vectors (3)
Interest in protein/lysate? Submit request here!
USD 198.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Pigyl |
Synonyms | 1810008A14Rik; PIG-Y; Pigy |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200384 representing BC025114
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCTGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200384 representing BC025114
Red=Cloning site Green=Tags(s) MRSRDKGKIRQERTRMRTELFKQLSFLETVNLLRREEDDPVPAHHDRPHPTGLAGRPALLRLCGGRLPRG LHQRQQPVLLQLALAGHRACVRVLPSVDMDGPEALQT myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | BC025114 |
ORF Size | 323 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | BC025114 |
RefSeq Size | 664 bp |
RefSeq ORF | 323 bp |
Locus ID | 66268 |
Cytogenetics | 9 A3 |
MW | 24.3 kDa |
Gene Summary | This gene encodes a homolog of a human protein that functions in glycosylphosphatidylinositol biosynthesis. The human protein is expressed from an unusual locus that encodes two distinct proteins in upstream and downstream CDSes; however, in mouse these two proteins are expressed from distinct loci. The product of this locus is highly similar to the protein expressed from the human downstream CDS. A separate mouse locus on chromosome 6 is orthologous to the human locus and encodes a protein similar to the human protein expressed from the upstream CDS. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MG200384 | (tGFP-tagged) - Mouse cDNA clone MGC:35756 IMAGE:4925089 |
USD 365.00 |
|
MR200384L3 | Lenti ORF clone of MGC:35756 (Myc-DDK-tagged) - Mouse cDNA clone MGC:35756 IMAGE:4925089 |
USD 465.00 |
|
MR200384L4 | Lenti ORF clone of MGC:35756 (mGFP-tagged) - Mouse cDNA clone MGC:35756 IMAGE:4925089 |
USD 465.00 |
{0} Product Review(s)
Be the first one to submit a review