OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Antibody All anti-Loxl2 antibodies

Anti-Loxl2 Antibody

div

Specifications Citations (1) Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA335061 Rabbit Polyclonal Anti-Loxl2 Antibody 50ug $325 3-7 days
Add to Shopping Cart
spacer
WB(1)

OriGene Data

ImmunogenThe immunogen for anti-Loxl2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTYYDLLSLNGTKVAEGHKA
Clone Name IsotypeIgG
Species ReactivityBovine, Human, Rat, Dog, Horse, Rabbit, Guinea pig ConcentrationLot dependent; please refer to CoA along with shipment
Guaranteed Application *WB Suggested DilutionsWB
Predicted MW Explanation 85 kDa
BufferShipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 83%

Reference Data

Target NameMus musculus lysyl oxidase-like 2 (Loxl2)
Alternative Name1110004B06Rik; 4930526G11Rik; 9430067E15Rik
Database LinkNP_201582
Entrez Gene 4017 Human
Entrez Gene 0 Mouse
Entrez Gene 290350 Rat
Entrez Gene 0 Monkey
Entrez Gene 486118 Dog
FunctionThe function of this protein remains unknown.
Related Pathway

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.


WB Image
WB Suggested Anti-Loxl2 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Heart
grey_line

 

spacer
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge